Schedule and confirm revenue ops meetings with Pipedrive, Google Calendar and Slack — рабочий процесс n8n

Средняя сложность Триггер8 узлов🤗 Support👁 2 просмотровот Ahmed Salama

Обзор

Categories
CRM Automation, Revenue Operations, Sales Operations, Meeting Automation

Build a Revenue Ops Meeting Pipeline with Pipedrive, Calendar, Slack

This workflow creates a CRM-driven revenue operations meeting pipeline that automatically coordinates meetings once a deal reaches a specific stage in Pipedrive.

When a deal moves into the Meeting Booking stage, the workflow waits for the SDR to complete the meeting details, creates the event in Google Calendar, sends a confirmation email t

Использованные узлы

PipedriveSlackGoogle CalendarGmail

Предпросмотр рабочего процесса

📌 Template Overview (Read Before Using)
What is it
This template is a Revenue Ops meeting automation that
When a deal
Pipedrive Trigger
Why it exists
Listens for deal updates so automation runs only when s
You can change
- Pipeline ID
- Stage ID (for example, use a di
Wait Node
Why it exists
Prevents the workflow from running before the SDR finis
You can change
- Wait time duration
- Replace with a conditional check ins
IF Stage Check
Why it exists
Ensures the workflow only runs for qualified deals and
You can change
- Stage ID value
- Add multiple allowed stages
Extract Deal Info
Why it exists
Pulls complete and reliable data directly from Pipedriv
You can change
- Fields extracted from the deal
- Add custom fields
Set / Transform Data
Why it exists
Cleans and prepares data so downstream tools receive co
You can change
- Time zone
- Date and time calculations
Create Calendar Event
Why it exists
Creates a single source of truth for the meeting and av
You can change
- Calendar selection
- Meeting title and description
Send Email Reminder
Why it exists
Confirms the meeting with the client and reduces no-sho
You can change
- Email wording
- Sender account
Send Slack Notification
Why it exists
Keeps the sales team informed without checking the CRM.
You can change
- Target channel
- Message format
Video Tutorial
@youtube
P
Pipedrive Trigger
I
If stage_id is 2 (Meetin…
Extract deal info
W
Wait untill the SDR subm…
G
Get meeting link URL, St…
Create a meeting and add…
Send Email reminder to t…
Send a reminder to SDR i…
8 nodes7 edges

Как это работает

  1. 1

    Триггер

    Рабочий процесс запускается триггером триггер.

  2. 2

    Обработка

    Данные проходят через 8 узлов, connecting gmail, googlecalendar, if.

  3. 3

    Вывод

    Рабочий процесс завершает автоматизацию и доставляет результат в настроенное место назначения.

Детали узлов (8)

PI

Pipedrive

pipedrive

#1
SL

Slack

slack

#2
GO

Google Calendar

googleCalendar

#3
GM

Gmail

gmail

#4

Как импортировать этот рабочий процесс

  1. 1Нажмите кнопку Скачать JSON справа, чтобы сохранить файл рабочего процесса.
  2. 2Откройте ваш экземпляр n8n. Перейдите в Рабочие процессы → Новый → Импорт из файла.
  3. 3Выберите скачанный файл schedule-and-confirm-revenue-ops-meetings-with-pipedrive-google-calendar-and-slack и нажмите Импортировать.
  4. 4Настройте учётные данные для каждого узла сервиса (ключи API, OAuth и т.д.).
  5. 5Нажмите Протестировать рабочий процесс, чтобы убедиться в правильной работе, затем активируйте его.

Или вставьте напрямую в n8n → Импорт из JSON:

{ "name": "Schedule and confirm revenue ops meetings with Pipedrive, Google Calendar and Slack", "nodes": [...], ...}

Интеграции

gmailgooglecalendarifpipedrivepipedrivetriggersetslackwait

Получить этот рабочий процесс

Скачайте и импортируйте одним кликом

Скачать JSONПросмотреть на n8n.io
Узлы8
Сложностьmedium
Триггерtrigger
Просмотры2
КатегорияSupport

Создан

Ahmed Salama

Ahmed Salama

@ahmedsalama

Теги

gmailgooglecalendarifpipedrivepipedrivetriggersetslackwait

Новичок в n8n?

n8n — бесплатный инструмент автоматизации рабочих процессов с открытым исходным кодом. Разверните самостоятельно или используйте облачную версию.

Получить n8n бесплатно →

Related Support Workflows

EMFIGOGO+5
medium

Scalable Cold Email Automation via Google Docs & n8n

Stop wasting hours manually copy-pasting email content. This high-performance n8n workflow transforms your Google Sheets database into a dynamic outreach engine. By leveraging Google Docs as a centralized template manager, you can maintain rich formatting while injecting personalized variables like first names, company details, and custom offers into every message. Unlike basic mail merges, this automation features a sophisticated 'Split in Batches' logic and integrated 'Wait' nodes to ensure your SMTP server remains in good standing, effectively bypassing spam filters associated with high-frequency sending. The process begins by fetching contact data, merging it with your Doc-based template, and executing a controlled delivery sequence. This is the ideal solution for growth teams and account managers who need the flexibility of a CRM without the high monthly costs. Whether you are sending monthly newsletters or executing targeted sales sequences, this workflow provides a robust, self-hosted alternative to expensive marketing platforms, giving you full control over your deliverability and data privacy. **Common Use Cases:** - Personalized B2B Sales Outreach: Automatically pull lead data from a spreadsheet to send customized cold pitches that look hand-written. - Automated Client Onboarding: Trigger a welcome sequence that pulls specific project details from a Master Sheet into a formatted Google Doc welcome letter. - Internal Corporate Announcements: Distribute tailored department updates to hundreds of employees with personalized performance metrics or specific team instructions.

Scheduled·12 nodes
DIEXIFMA+2
medium

How to Map Discord Server Structure with n8n (API Tutorial)

Architecting a robust Discord automation begins with a precise understanding of your server's hierarchy. This advanced n8n template serves as a diagnostic and structural mapping tool, moving beyond basic connectivity tests to provide a comprehensive audit of your Discord environment. By programmatically fetching every category and channel ID, it eliminates the manual guesswork often associated with configuring Discord bots. The workflow utilizes a strategic multi-step approach: first, it validates your OAuth2 or Bot Token credentials; next, it executes a recursive GET request to the Discord API; and finally, it parses the JSON response into a clean, actionable data structure. For businesses scaling community operations, this flow is essential for auditing permissions, preparing for mass-message deployments, or syncing server structures with external databases. Instead of hard-coding channel IDs, use this workflow to dynamically discover your server's architecture, ensuring your automated workflows remain resilient even when channels are renamed or reorganized. **Common Use Cases:** - Dynamic Channel Mapping for Automated Community Onboarding - Automated Security Audits of Discord Server Permissions and Categories - Database Synchronization of Server Structures for Multi-Tenant Bot Management

Trigger·9 nodes
COFIGMGO+5
medium

Automate GoHighLevel Contract Renewals: Slack & Gmail Sync

Stop losing revenue to expired contracts and missed follow-ups. This professional n8n automation creates a fail-safe system for client retention by bridging GoHighLevel CRM with your team's communication stack. Instead of manually auditing account dates, this workflow autonomously scans your GHL database every morning to identify subscriptions or agreements set to expire within a 10-day window. The logic begins with a scheduled trigger that pulls comprehensive client data, passing it through a validation and filtering layer to ensure only active, relevant accounts are processed. Once an expiring contract is identified, the workflow executes a multi-channel notification strategy: it sends a personalized, high-touch email via Gmail to the client, alerts the dedicated account manager via Slack for immediate awareness, and logs the entire event in Google Sheets for executive reporting. By centralizing renewal tracking and automating the outreach phase, agencies can significantly increase their LTV (Lifetime Value) and eliminate the human error associated with manual CRM management. This is an essential template for any high-growth agency looking to scale their operations without increasing administrative overhead. **Common Use Cases:** - SaaS Subscription Recovery: Automatically notify users 10 days before their annual plan expires to prevent involuntary churn. - Marketing Agency Retainer Tracking: Alert account managers when a client's 6-month service agreement is nearing completion to trigger upsell conversations. - Professional Service Compliance: Track certification or insurance expiration dates for vendors managed within GoHighLevel and maintain a master log in Google Sheets.

Scheduled·10 nodes
COGMGOIF+5
medium

Automate AI Customer Sentiment Analysis & PDF Reporting (n8n)

This advanced n8n workflow revolutionizes how businesses handle user input by transforming raw feedback into high-level business intelligence. Instead of manually sorting through surveys, this automation leverages OpenAI to perform instant sentiment analysis and categorization. The engine processes incoming webhooks, uses custom JavaScript logic to structure data, and generates professional-grade PDF summary reports via HTML/CSS conversion. To ensure stakeholders stay informed, it executes a multi-channel distribution strategy: archiving data in Google Sheets for long-term tracking, alerting teams via Slack for immediate action, and sending personalized follow-up emails through Gmail. This end-to-end pipeline eliminates manual data entry and ensures that critical customer pain points are addressed in real-time. It is the perfect solution for Product Managers and Success Teams who need to scale their feedback loops without increasing headcount, providing a transparent, documented trail of customer satisfaction trends from the moment a form is submitted. **Common Use Cases:** - SaaS Product Feedback & Feature Request Prioritization - Post-Purchase E-commerce Satisfaction Surveys with Executive Reporting - Automated B2B Client Health Scoring and Account Management Alerts

🔗 Webhook·12 nodes
@AGMLIOP+2
medium

Sync LinkedIn Posts to Email Newsletters via AI & Apify

This advanced n8n automation bridges the gap between social media presence and direct email marketing, ensuring your best insights never go to waste. By integrating Apify’s scraping capabilities with GPT-4’s generative intelligence, the workflow systematically extracts your latest LinkedIn updates and refines them into polished, subscriber-ready newsletter drafts. It begins with a scheduled trigger that initiates an Apify actor to fetch recent profile activity. The raw data is then processed through OpenAI’s Large Language Models, which summarize the key takeaways, adjust the tone for an email audience, and generate compelling subject lines. Finally, the formatted content is dispatched via Gmail, effectively turning your social feed into a self-sustaining content engine. This is an essential tool for thought leaders and agency owners who need to maintain a multi-channel presence without doubling their production time. It eliminates the friction of manual copy-pasting and ensures your email list stays engaged with your most current professional insights automatically. **Common Use Cases:** - Personal Brand Content Multiplier - Automated Weekly Thought Leadership Digest - B2B Social-to-Email Marketing Funnel

Scheduled·7 nodes