Query and Monitor Shopify Orders via Telegram Bot Commands — n8n Workflow

Gemiddeld complexiteit Trigger11 knooppunten⚒️ Engineering👁 574 weergavendoor Roninimous

Overzicht

This n8n workflow integrates Shopify order management with Telegram, allowing you to query open orders and order details directly through Telegram chat commands. It provides an interactive way to monitor your Shopify store orders using Telegram as an interface.

Key Features

Telegram Trigger: Listens for messages and callback queries from your Telegram bot. Switch Node: Routes incoming Telegram messages to different flows based on message content: /orders command to fetch all open orders Cal

Gebruikte knooppunten

HTTP RequestTelegramShopifyCode

Workflow-voorvertoning

T
Telegram Trigger
get Orders
Orders
No Order
get Order
Clean Up Order
C
Check If There's Any Order
G
Get All Orders/Get An Or…
Get Order ID
Send Orders to Telegram
Send Order Details
11 nodes11 edges

Hoe het werkt

  1. 1

    Trigger

    De workflow start met een trigger-trigger.

  2. 2

    Verwerking

    Gegevens stromen door 11 knooppunten, connecting code, httprequest, if.

  3. 3

    Uitvoer

    De workflow voltooit zijn automatisering en levert het resultaat aan de geconfigureerde bestemming.

Knooppuntdetails (11)

HT

HTTP Request

httpRequest

#1
TE

Telegram

telegram

#2
SH

Shopify

shopify

#3
CO

Code

code

#4

Hoe deze workflow te importeren

  1. 1Klik op de knop JSON downloaden rechts om het workflowbestand op te slaan.
  2. 2Open uw n8n-instantie. Ga naar Workflows → Nieuw → Importeren uit bestand.
  3. 3Selecteer het gedownloade bestand query-and-monitor-shopify-orders-via-telegram-bot-commands en klik op Importeren.
  4. 4Stel inloggegevens in voor elk serviceknooppunt (API-sleutels, OAuth, enz.).
  5. 5Klik op Workflow testen om te controleren of alles werkt, activeer het vervolgens.

Of plak rechtstreeks in n8n → Importeren uit JSON:

{ "name": "Query and Monitor Shopify Orders via Telegram Bot Commands", "nodes": [...], ...}

Integraties

codehttprequestifshopifyswitchtelegramtelegramtrigger

Haal deze workflow op

Download en importeer met één klik

JSON downloadenBekijken op n8n.io
Knooppunten11
Complexiteitmedium
Triggertrigger
Weergaven574
CategorieEngineering

Gemaakt door

Roninimous

Roninimous

@roninimous

Tags

codehttprequestifshopifyswitchtelegramtelegramtrigger

Nieuw bij n8n?

n8n is een gratis open-source workflow-automatiseringstool. Host het zelf of gebruik de cloudversie.

n8n gratis ophalen →

Related Engineering Workflows

COGOHTIF+5
high

Automate YooKassa Payments & Order Logs in Google Sheets

Transform your payment operations with this comprehensive n8n automation designed for seamless YooKassa integration. Instead of manual data entry, this workflow creates a self-correcting financial ledger by syncing every transaction directly into Google Sheets in real-time. The logic handles the entire commerce lifecycle: from the moment a customer initiates a checkout to the final status confirmation via secure webhooks. What sets this template apart is its robust error-handling and multi-stage processing. It doesn't just log successful sales; it intelligently updates refund statuses, sorts transaction types, and uses conditional logic to ensure your spreadsheet remains a 'single source of truth.' By utilizing the Respond to Webhook node, the workflow provides immediate feedback to the payment gateway, ensuring high reliability. This is an enterprise-grade solution for small business owners who need to scale their digital sales without the overhead of expensive ERP software or manual bookkeeping. It eliminates human error, accelerates fulfillment, and provides a transparent audit trail for every ruble processed. **Common Use Cases:** - Automated Digital Product Delivery: Trigger instant access to downloads or courses once the YooKassa payment status is verified in the sheet. - Real-time Financial Reporting: Maintain a live dashboard of sales performance and refund rates for e-commerce stakeholders without manual exports. - No-code Subscription Management: Track recurring customer payments and trial expirations by logging every transaction event into a centralized Google Sheets database.

🔗 Webhook·39 nodes
COGOHTMA
low

Automate Google AI Overview Tracking: SEO Audit with SerpApi

As Google’s Search Generative Experience (SGE) reshapes the digital landscape, traditional SEO metrics often fall short. This advanced n8n workflow bridges the data gap by providing a scalable solution for monitoring brand visibility within AI Overviews. By integrating SerpApi with Google Sheets, the automation systematically audits your target keyword clusters to detect AI-generated summaries and source citations. The process begins by pulling high-priority keywords directly from your repository. It then executes real-time search queries via SerpApi, utilizing custom JavaScript in a Code node to parse complex JSON responses. The workflow specifically identifies if an AI Overview is present and, more importantly, whether your domain is cited as a primary source. All findings are exported into a structured Google Sheet, creating a historical record of your 'AI Share of Voice.' This automation saves SEO teams dozens of manual hours, allowing for data-driven adjustments to content strategy based on how Google’s LLM perceives and attributes your site’s authority. It is an essential tool for agencies and enterprise SEOs looking to defend their organic traffic in the age of generative search. **Common Use Cases:** - SGE Visibility Benchmarking vs Competitors - Automated AI Citation Reporting for SEO Clients - Content Strategy Optimization for Informational Intent Queries

Trigger·5 nodes
EDFOGIGM+3
medium

Automate Dynamic GitHub Images & URL Redirects in n8n

Stop manually updating marketing assets across distributed channels. This professional n8n automation eliminates the 'stale content' problem by transforming static GitHub-hosted images and links into dynamic, self-updating resources. Instead of hunting down every email template or PDF where you've embedded a promotional banner, this workflow allows you to push updates to a central GitHub repository that automatically reflects across all live instances. The workflow functions by utilizing GitHub as a headless content management system. It leverages the EditImage node to programmatically modify visual assets and the GitHub node to commit these changes automatically. It includes a Form Trigger for on-demand updates and a Schedule Trigger for recurring maintenance. By using stable embed links that point to dynamic GitHub files, your marketing collateral remains evergreen. Whether you are updating a limited-time offer in an old email sequence or refreshing data visualizations in a shared report, this automation ensures your audience always sees the most current information without requiring manual re-distribution of files. **Common Use Cases:** - Automated Email Banner Updates for Evergreen Campaigns - Dynamic GitHub Profile Readme & Repository Statistics - Centralized Promo Link Management for Distributed PDF Guides

Trigger·12 nodes
AGCOEXGI+8
medium

Automate Jekyll SEO Blogs with GPT-4 and GitHub (n8n Guide)

This sophisticated automation engine transforms your content strategy by bridging the gap between raw data and a live, high-ranking Jekyll website. Instead of manually drafting and formatting Markdown files, this workflow utilizes an advanced LangChain agent powered by GPT-4 to synthesize high-quality, long-form articles from simple CSV inputs. The system intelligently parses your data, constructs SEO-optimized blog posts, and handles the technical heavy lifting by committing the code directly to your GitHub repository. This triggers your CI/CD pipeline for instant deployment. Beyond just publishing, the workflow acts as a social media manager, automatically distributing your new content to LinkedIn and X (Twitter) to maximize reach and backlinks. It is an ideal solution for lean marketing teams or solo developers who need to maintain a consistent publishing cadence without the overhead of a traditional CMS. By automating the research, writing, and distribution phases, users can scale their organic traffic exponentially while focusing on high-level strategy rather than repetitive formatting and manual commits. **Common Use Cases:** - Programmatic SEO for Niche Affiliate Marketing Sites - Automated Technical Documentation and Change Log Updates - Scalable Content Engine for Multi-Language Recipe or Directory Portals

Trigger·13 nodes
AGCOEMEM+5
medium

Build a Local AI Book Concierge with Ollama & n8n

Transform your inbox into an intelligent, automated literary assistant with this advanced n8n workflow. By leveraging the power of local LLMs through Ollama and the OpenLibrary API, this automation eliminates the manual effort of responding to reading inquiries. The process begins by monitoring an IMAP folder for incoming requests. Once an email arrives, a sophisticated AI agent analyzes the sender's natural language to pinpoint their specific interests and genre preferences. The workflow then executes a real-time API lookup to fetch accurate bibliographical data, including summaries and metadata. Finally, it crafts and sends a professional, personalized recommendation email back to the user. This setup is perfect for organizations looking to deploy privacy-focused AI solutions without relying on expensive cloud tokens. It demonstrates a high-level integration of LangChain agents, conditional logic, and external data enrichment, providing a seamless 'set-and-forget' experience for managing high volumes of literary or educational inquiries while maintaining a human-like touch in communication. **Common Use Cases:** - Personalized Reading Lists for Digital Newsletters - Automated Curriculum Support for Educational Institutions - Privacy-First Customer Engagement for Local Bookstores

▶️ Manual·15 nodes
AGCOFIGM+6
medium

Automate HubSpot AI Email Replies with Slack Approval (n8n)

This advanced n8n automation bridges the gap between AI-driven speed and human-verified precision. By integrating Google Gemini with your HubSpot CRM, the workflow automatically generates context-aware email responses whenever a new inquiry hits your Gmail inbox. Unlike basic auto-responders, this system queries your HubSpot records—including contact history, active deals, and support tickets—to ensure every draft is personalized and accurate. To maintain brand integrity, the draft isn't sent immediately; instead, it is routed to a dedicated Slack channel via an interactive message. Your team can review, edit, or approve the reply with a single click, triggering the final send via Gmail. This eliminates the manual overhead of switching between tabs to find customer data and drafting repetitive emails from scratch. It is the perfect solution for scaling customer operations without hiring additional headcount, ensuring that every outbound communication is data-backed and professionally vetted. The workflow utilizes LangChain agents for intelligent reasoning, filtering out internal noise to focus purely on high-value customer interactions. **Common Use Cases:** - High-priority sales lead nurturing where quick, data-informed follow-ups are critical for conversion. - Technical support escalation where AI drafts troubleshooting steps based on existing HubSpot ticket history. - Account management automation for handling routine client inquiries with personalized data from active deals.

Trigger·13 nodes