Detect Stock Price Anomalies & Send News Alerts with Marketstack, HackerNews & DeepL — n8n 워크플로

보통 복잡도 예약12개의 노드🤗 Support작성자: noda

개요

Price Anomaly Detection & News Alert (Marketstack + HN + DeepL + Slack)

Overview This workflow monitors a stock’s closing price via Marketstack. It computes a 20-day moving average and standard deviation (±2σ). If the latest close is outside ±2σ, it flags an anomaly, fetches related headlines from Hacker News, translates them to Japanese with DeepL, and posts both original and translated text to Slack. When no anomaly is detected, it sends a concise “normal” report.

How it works

  1. Daily trigg

사용된 노드

SlackHacker NewsDeepLMarketstackCode

워크플로 미리보기

Loading workflow preview...

작동 원리

  1. 1

    트리거

    워크플로는 예약 트리거로 시작합니다, 정해진 일정에 따라 실행.

  2. 2

    처리

    데이터가 12개의 노드를 통해 흐릅니다, connecting code, deepl, hackernews.

  3. 3

    출력

    워크플로가 자동화를 완료하고 구성된 대상에 결과를 전달합니다.

노드 세부 정보 (12)

SL

Slack

slack

#1
HA

Hacker News

hackerNews

#2
DE

DeepL

deepL

#3
MA

Marketstack

marketstack

#4
CO

Code

code

#5

이 워크플로 가져오는 방법

  1. 1오른쪽의 JSON 다운로드 버튼을 클릭하여 워크플로 파일을 저장합니다.
  2. 2n8n 인스턴스를 열고 워크플로 → 새로 만들기 → 파일에서 가져오기로 이동합니다.
  3. 3다운로드된 detect-stock-price-anomalies-send-news-alerts-with-marketstack-hackernews-deepl 파일을 선택하고 가져오기를 클릭합니다.
  4. 4각 서비스 노드에 대한 자격 증명(API 키, OAuth 등)을 설정합니다.
  5. 5워크플로 테스트를 클릭하여 모든 것이 작동하는지 확인한 후 활성화합니다.

또는 n8n → JSON에서 가져오기에 직접 붙여넣기:

{ "name": "Detect Stock Price Anomalies & Send News Alerts with Marketstack, HackerNews & DeepL", "nodes": [...], ...}

통합

codedeeplhackernewsifmarketstackmergescheduletriggersetslack

이 워크플로 가져오기

한 번의 클릭으로 다운로드 및 가져오기

n8n.io에서 보기
노드12
복잡도medium
트리거scheduled
카테고리Support

제작자

noda

noda

@shusaku

태그

codedeeplhackernewsifmarketstackmergescheduletriggersetslack

n8n을 처음 사용하시나요?

n8n은 무료 오픈소스 워크플로 자동화 도구입니다. 자체 호스팅하거나 클라우드 버전을 사용하세요.

n8n 무료로 시작하기 →

Related Support Workflows

EMFIGOGO+5
medium

Scalable Cold Email Automation via Google Docs & n8n

Stop wasting hours manually copy-pasting email content. This high-performance n8n workflow transforms your Google Sheets database into a dynamic outreach engine. By leveraging Google Docs as a centralized template manager, you can maintain rich formatting while injecting personalized variables like first names, company details, and custom offers into every message. Unlike basic mail merges, this automation features a sophisticated 'Split in Batches' logic and integrated 'Wait' nodes to ensure your SMTP server remains in good standing, effectively bypassing spam filters associated with high-frequency sending. The process begins by fetching contact data, merging it with your Doc-based template, and executing a controlled delivery sequence. This is the ideal solution for growth teams and account managers who need the flexibility of a CRM without the high monthly costs. Whether you are sending monthly newsletters or executing targeted sales sequences, this workflow provides a robust, self-hosted alternative to expensive marketing platforms, giving you full control over your deliverability and data privacy. **Common Use Cases:** - Personalized B2B Sales Outreach: Automatically pull lead data from a spreadsheet to send customized cold pitches that look hand-written. - Automated Client Onboarding: Trigger a welcome sequence that pulls specific project details from a Master Sheet into a formatted Google Doc welcome letter. - Internal Corporate Announcements: Distribute tailored department updates to hundreds of employees with personalized performance metrics or specific team instructions.

Scheduled·12 nodes
DIEXIFMA+2
medium

How to Map Discord Server Structure with n8n (API Tutorial)

Architecting a robust Discord automation begins with a precise understanding of your server's hierarchy. This advanced n8n template serves as a diagnostic and structural mapping tool, moving beyond basic connectivity tests to provide a comprehensive audit of your Discord environment. By programmatically fetching every category and channel ID, it eliminates the manual guesswork often associated with configuring Discord bots. The workflow utilizes a strategic multi-step approach: first, it validates your OAuth2 or Bot Token credentials; next, it executes a recursive GET request to the Discord API; and finally, it parses the JSON response into a clean, actionable data structure. For businesses scaling community operations, this flow is essential for auditing permissions, preparing for mass-message deployments, or syncing server structures with external databases. Instead of hard-coding channel IDs, use this workflow to dynamically discover your server's architecture, ensuring your automated workflows remain resilient even when channels are renamed or reorganized. **Common Use Cases:** - Dynamic Channel Mapping for Automated Community Onboarding - Automated Security Audits of Discord Server Permissions and Categories - Database Synchronization of Server Structures for Multi-Tenant Bot Management

Trigger·9 nodes
COFIGMGO+5
medium

Automate GoHighLevel Contract Renewals: Slack & Gmail Sync

Stop losing revenue to expired contracts and missed follow-ups. This professional n8n automation creates a fail-safe system for client retention by bridging GoHighLevel CRM with your team's communication stack. Instead of manually auditing account dates, this workflow autonomously scans your GHL database every morning to identify subscriptions or agreements set to expire within a 10-day window. The logic begins with a scheduled trigger that pulls comprehensive client data, passing it through a validation and filtering layer to ensure only active, relevant accounts are processed. Once an expiring contract is identified, the workflow executes a multi-channel notification strategy: it sends a personalized, high-touch email via Gmail to the client, alerts the dedicated account manager via Slack for immediate awareness, and logs the entire event in Google Sheets for executive reporting. By centralizing renewal tracking and automating the outreach phase, agencies can significantly increase their LTV (Lifetime Value) and eliminate the human error associated with manual CRM management. This is an essential template for any high-growth agency looking to scale their operations without increasing administrative overhead. **Common Use Cases:** - SaaS Subscription Recovery: Automatically notify users 10 days before their annual plan expires to prevent involuntary churn. - Marketing Agency Retainer Tracking: Alert account managers when a client's 6-month service agreement is nearing completion to trigger upsell conversations. - Professional Service Compliance: Track certification or insurance expiration dates for vendors managed within GoHighLevel and maintain a master log in Google Sheets.

Scheduled·10 nodes
COGMGOIF+5
medium

Automate AI Customer Sentiment Analysis & PDF Reporting (n8n)

This advanced n8n workflow revolutionizes how businesses handle user input by transforming raw feedback into high-level business intelligence. Instead of manually sorting through surveys, this automation leverages OpenAI to perform instant sentiment analysis and categorization. The engine processes incoming webhooks, uses custom JavaScript logic to structure data, and generates professional-grade PDF summary reports via HTML/CSS conversion. To ensure stakeholders stay informed, it executes a multi-channel distribution strategy: archiving data in Google Sheets for long-term tracking, alerting teams via Slack for immediate action, and sending personalized follow-up emails through Gmail. This end-to-end pipeline eliminates manual data entry and ensures that critical customer pain points are addressed in real-time. It is the perfect solution for Product Managers and Success Teams who need to scale their feedback loops without increasing headcount, providing a transparent, documented trail of customer satisfaction trends from the moment a form is submitted. **Common Use Cases:** - SaaS Product Feedback & Feature Request Prioritization - Post-Purchase E-commerce Satisfaction Surveys with Executive Reporting - Automated B2B Client Health Scoring and Account Management Alerts

🔗 Webhook·12 nodes
@AGMLIOP+2
medium

Sync LinkedIn Posts to Email Newsletters via AI & Apify

This advanced n8n automation bridges the gap between social media presence and direct email marketing, ensuring your best insights never go to waste. By integrating Apify’s scraping capabilities with GPT-4’s generative intelligence, the workflow systematically extracts your latest LinkedIn updates and refines them into polished, subscriber-ready newsletter drafts. It begins with a scheduled trigger that initiates an Apify actor to fetch recent profile activity. The raw data is then processed through OpenAI’s Large Language Models, which summarize the key takeaways, adjust the tone for an email audience, and generate compelling subject lines. Finally, the formatted content is dispatched via Gmail, effectively turning your social feed into a self-sustaining content engine. This is an essential tool for thought leaders and agency owners who need to maintain a multi-channel presence without doubling their production time. It eliminates the friction of manual copy-pasting and ensures your email list stays engaged with your most current professional insights automatically. **Common Use Cases:** - Personal Brand Content Multiplier - Automated Weekly Thought Leadership Digest - B2B Social-to-Email Marketing Funnel

Scheduled·7 nodes