Detect Stock Price Anomalies & Send News Alerts with Marketstack, HackerNews & DeepL — Workflow n8n

Moyen complexité Planifié12 nœuds🤗 Supportpar noda

Aperçu

Price Anomaly Detection & News Alert (Marketstack + HN + DeepL + Slack)

Overview This workflow monitors a stock’s closing price via Marketstack. It computes a 20-day moving average and standard deviation (±2σ). If the latest close is outside ±2σ, it flags an anomaly, fetches related headlines from Hacker News, translates them to Japanese with DeepL, and posts both original and translated text to Slack. When no anomaly is detected, it sends a concise “normal” report.

How it works

  1. Daily trigg

Nœuds utilisés

SlackHacker NewsDeepLMarketstackCode

Aperçu du workflow

Daily Check (09:00 JST)
Starts the workflow every morning at 09:00 JST. Adjust
Get Stock Data (Marketstack)
Retrieves the latest EOD prices for the configured tick
Customization Tips
- Monitor multiple tickers: duplicate Get Stock Data an
- Replace Hacker News with NewsAPI / Google News RSS fo
- Switch Slack to
Node Structure Overview
Flow:
🕘 Daily Check (09:00)
→ 📊 Get Stock Data (Marketstack)
→ 🧮 Calculate Deviation (±2σ)
→ 🔀 IF: Is Anomaly? (status != "normal")
Send Normal Report to Slack
Sends a concise “no anomaly” message with basic stats.
🛠️ Setup Instructions
1. Connect your Marketstack, DeepL, and Slack credentia
2. Update ticker symbol inside “Get Stock Data”.
3. Customize Slack channel in both Slack nodes.
4. Mod
Price Anomaly Detection & News Alert (Markets
Overview
This workflow monitors a stock’s closing price via Mark
Calculate Deviation
Computes 20-day mean and standard deviation; classifies
Is Anomaly? (status != "normal")
Branches to the news path only when the latest close ex
Get Related News (Hacker News)
Searches articles by the ticker/company keyword. You ca
Format News (Title + Summary + URL)
Cleans HTML (e.g., <em>) and formats top items for tran
Translate News (EN → JA)
DeepL translation to Japanese. Change target_lang if ne
Merge Original + Translated
Appends original English and translated Japanese into o
Send Alert to Slack (Anomaly)
Sends bilingual alert with stats (latest, mean, σ) and
D
Daily Check
Get Stock Data
Calculate Deviation
I
Is Anomaly? (status != "…
Get Related News
Translate News
Send Alert to Slack
Send Normal Report to Sl…
M
Merge Original + Transla…
A
Add Symbol Field
Compose Slack Message
Build News Keyword
12 nodes12 edges

Comment ça fonctionne

  1. 1

    Déclencheur

    Le workflow démarre avec un déclencheur planifié, s'exécutant selon un planning défini.

  2. 2

    Traitement

    Les données transitent par 12 nœuds, connecting code, deepl, hackernews.

  3. 3

    Sortie

    Le workflow termine son automatisation et livre le résultat à la destination configurée.

Détails des nœuds (12)

SL

Slack

slack

#1
HA

Hacker News

hackerNews

#2
DE

DeepL

deepL

#3
MA

Marketstack

marketstack

#4
CO

Code

code

#5

Comment importer ce workflow

  1. 1Cliquez sur le bouton Télécharger JSON à droite pour enregistrer le fichier du workflow.
  2. 2Ouvrez votre instance n8n. Accédez à Workflows → Nouveau → Importer depuis un fichier.
  3. 3Sélectionnez le fichier detect-stock-price-anomalies-send-news-alerts-with-marketstack-hackernews-deepl téléchargé et cliquez sur Importer.
  4. 4Configurez les identifiants pour chaque nœud de service (clés API, OAuth, etc.).
  5. 5Cliquez sur Tester le workflow pour vérifier que tout fonctionne, puis activez-le.

Ou collez directement dans n8n → Importer depuis JSON :

{ "name": "Detect Stock Price Anomalies & Send News Alerts with Marketstack, HackerNews & DeepL", "nodes": [...], ...}

Intégrations

codedeeplhackernewsifmarketstackmergescheduletriggersetslack

Obtenir ce workflow

Téléchargez et importez en un clic

Télécharger JSONVoir sur n8n.io
Nœuds12
Complexitémedium
Déclencheurscheduled
CatégorieSupport

Créé par

noda

noda

@shusaku

Tags

codedeeplhackernewsifmarketstackmergescheduletriggersetslack

Nouveau sur n8n ?

n8n est un outil d'automatisation de workflows gratuit et open-source. Hébergez-le vous-même ou utilisez la version cloud.

Obtenir n8n gratuitement →

Related Support Workflows

EMFIGOGO+5
medium

Scalable Cold Email Automation via Google Docs & n8n

Stop wasting hours manually copy-pasting email content. This high-performance n8n workflow transforms your Google Sheets database into a dynamic outreach engine. By leveraging Google Docs as a centralized template manager, you can maintain rich formatting while injecting personalized variables like first names, company details, and custom offers into every message. Unlike basic mail merges, this automation features a sophisticated 'Split in Batches' logic and integrated 'Wait' nodes to ensure your SMTP server remains in good standing, effectively bypassing spam filters associated with high-frequency sending. The process begins by fetching contact data, merging it with your Doc-based template, and executing a controlled delivery sequence. This is the ideal solution for growth teams and account managers who need the flexibility of a CRM without the high monthly costs. Whether you are sending monthly newsletters or executing targeted sales sequences, this workflow provides a robust, self-hosted alternative to expensive marketing platforms, giving you full control over your deliverability and data privacy. **Common Use Cases:** - Personalized B2B Sales Outreach: Automatically pull lead data from a spreadsheet to send customized cold pitches that look hand-written. - Automated Client Onboarding: Trigger a welcome sequence that pulls specific project details from a Master Sheet into a formatted Google Doc welcome letter. - Internal Corporate Announcements: Distribute tailored department updates to hundreds of employees with personalized performance metrics or specific team instructions.

Scheduled·12 nodes
DIEXIFMA+2
medium

How to Map Discord Server Structure with n8n (API Tutorial)

Architecting a robust Discord automation begins with a precise understanding of your server's hierarchy. This advanced n8n template serves as a diagnostic and structural mapping tool, moving beyond basic connectivity tests to provide a comprehensive audit of your Discord environment. By programmatically fetching every category and channel ID, it eliminates the manual guesswork often associated with configuring Discord bots. The workflow utilizes a strategic multi-step approach: first, it validates your OAuth2 or Bot Token credentials; next, it executes a recursive GET request to the Discord API; and finally, it parses the JSON response into a clean, actionable data structure. For businesses scaling community operations, this flow is essential for auditing permissions, preparing for mass-message deployments, or syncing server structures with external databases. Instead of hard-coding channel IDs, use this workflow to dynamically discover your server's architecture, ensuring your automated workflows remain resilient even when channels are renamed or reorganized. **Common Use Cases:** - Dynamic Channel Mapping for Automated Community Onboarding - Automated Security Audits of Discord Server Permissions and Categories - Database Synchronization of Server Structures for Multi-Tenant Bot Management

Trigger·9 nodes
COFIGMGO+5
medium

Automate GoHighLevel Contract Renewals: Slack & Gmail Sync

Stop losing revenue to expired contracts and missed follow-ups. This professional n8n automation creates a fail-safe system for client retention by bridging GoHighLevel CRM with your team's communication stack. Instead of manually auditing account dates, this workflow autonomously scans your GHL database every morning to identify subscriptions or agreements set to expire within a 10-day window. The logic begins with a scheduled trigger that pulls comprehensive client data, passing it through a validation and filtering layer to ensure only active, relevant accounts are processed. Once an expiring contract is identified, the workflow executes a multi-channel notification strategy: it sends a personalized, high-touch email via Gmail to the client, alerts the dedicated account manager via Slack for immediate awareness, and logs the entire event in Google Sheets for executive reporting. By centralizing renewal tracking and automating the outreach phase, agencies can significantly increase their LTV (Lifetime Value) and eliminate the human error associated with manual CRM management. This is an essential template for any high-growth agency looking to scale their operations without increasing administrative overhead. **Common Use Cases:** - SaaS Subscription Recovery: Automatically notify users 10 days before their annual plan expires to prevent involuntary churn. - Marketing Agency Retainer Tracking: Alert account managers when a client's 6-month service agreement is nearing completion to trigger upsell conversations. - Professional Service Compliance: Track certification or insurance expiration dates for vendors managed within GoHighLevel and maintain a master log in Google Sheets.

Scheduled·10 nodes
COGMGOIF+5
medium

Automate AI Customer Sentiment Analysis & PDF Reporting (n8n)

This advanced n8n workflow revolutionizes how businesses handle user input by transforming raw feedback into high-level business intelligence. Instead of manually sorting through surveys, this automation leverages OpenAI to perform instant sentiment analysis and categorization. The engine processes incoming webhooks, uses custom JavaScript logic to structure data, and generates professional-grade PDF summary reports via HTML/CSS conversion. To ensure stakeholders stay informed, it executes a multi-channel distribution strategy: archiving data in Google Sheets for long-term tracking, alerting teams via Slack for immediate action, and sending personalized follow-up emails through Gmail. This end-to-end pipeline eliminates manual data entry and ensures that critical customer pain points are addressed in real-time. It is the perfect solution for Product Managers and Success Teams who need to scale their feedback loops without increasing headcount, providing a transparent, documented trail of customer satisfaction trends from the moment a form is submitted. **Common Use Cases:** - SaaS Product Feedback & Feature Request Prioritization - Post-Purchase E-commerce Satisfaction Surveys with Executive Reporting - Automated B2B Client Health Scoring and Account Management Alerts

🔗 Webhook·12 nodes
@AGMLIOP+2
medium

Sync LinkedIn Posts to Email Newsletters via AI & Apify

This advanced n8n automation bridges the gap between social media presence and direct email marketing, ensuring your best insights never go to waste. By integrating Apify’s scraping capabilities with GPT-4’s generative intelligence, the workflow systematically extracts your latest LinkedIn updates and refines them into polished, subscriber-ready newsletter drafts. It begins with a scheduled trigger that initiates an Apify actor to fetch recent profile activity. The raw data is then processed through OpenAI’s Large Language Models, which summarize the key takeaways, adjust the tone for an email audience, and generate compelling subject lines. Finally, the formatted content is dispatched via Gmail, effectively turning your social feed into a self-sustaining content engine. This is an essential tool for thought leaders and agency owners who need to maintain a multi-channel presence without doubling their production time. It eliminates the friction of manual copy-pasting and ensures your email list stays engaged with your most current professional insights automatically. **Common Use Cases:** - Personal Brand Content Multiplier - Automated Weekly Thought Leadership Digest - B2B Social-to-Email Marketing Funnel

Scheduled·7 nodes