Auto-Translate YouTube Videos to Japanese with DeepL and Post to Slack — Flujo de trabajo n8n

Media complejidad▶️ Manual9 nodos🤗 Supportpor noda

Descripción general

Overview Auto-translate YouTube uploads to Japanese and post to Slack (DeepL + Slack)

Who’s it for Marketing or community teams that follow English-speaking creators but share updates with Japanese audiences; language learners who want JP summaries of newly released videos; internal comms teams curating industry channels for a JP workspace.

What it does This workflow detects new YouTube uploads, retrieves full metadata, translates the title and description into Japanese using DeepL, and posts

Nodos utilizados

SlackYouTubeDeepLCode

Vista previa del flujo de trabajo

Overview
Auto-translate YouTube uploads to Japanese and post to
Who’s it for
Marketing or community teams that follow English-speaki
Send a Message (Skipped)
📘 Setup Steps
1️⃣ Connect YouTube, DeepL, and Slack credentials
2️⃣ Update the RSS channel ID
3️⃣ Adjust Slack channel name if needed
4️⃣ Test with one video manually
Format YouTube Data for DeepL
🧠 Prepare Translation Input
Combines YouTube data into a single formatted text:
【Title】
{title}
【Description】
Language Filter
🔎 Filter English Titles Only
Skips non-English titles based on regex (^[A-Za-z0-9\\s
If true → proceed to translation.
If false → send “skipped” message to Slack.
RSS Trigger
⏰ Trigger for new uploads
Checks the target YouTube channel RSS feed for new vide
Automatically passes new entries to the next node.
Merge
🔗 Combine Original + Translated Data
Joins DeepL translation results with YouTube metadata.
Output: unified object ready for Slack posting.
Translate with DeepL
🌍 Translate text into Japanese
Uses the DeepL API (POST request).
Translates the combined YouTube text.
Returns JSON with translated output.
⚠️ Never hardcode API keys — store
Get a Video
🎬 Retrieve Full Video Details
Uses the YouTube API to fetch snippet information such
Input: video ID from RSS.
Output: structured JSON for downstream processin
Setup checklist
1) Connect: YouTube OAuth / DeepL / Slack
2) Open “Set (Config)” and fill: YT_CHANNEL_ID, TARGET_
3) Replace DeepL HTTP node with DeepL credential (no ha
Send to Slack
💬 Post Translated Message to Slack
Sends formatted message to a selected channel.
Includes both translated and original texts with a vide
Example output:
Format Translated Output
This Code node formats the DeepL translation result int
that can be sent to Slack or other integrations.
Input:
- Translated text (from DeepL)
- Ori
R
RSS Trigger
Send to Slack
Get a video
Send a message
L
Language Filter
Format YouTube Data for …
Translate a language
M
Merge YouTube + DeepL Re…
Format Translated Output
9 nodes9 edges

Cómo funciona

  1. 1

    Disparador

    El flujo de trabajo comienza con un disparador manual.

  2. 2

    Procesamiento

    Los datos fluyen a través de 9 nodos, connecting code, deepl, if.

  3. 3

    Salida

    El flujo de trabajo completa su automatización y entrega el resultado al destino configurado.

Detalles de nodos (9)

SL

Slack

slack

#1
YO

YouTube

youTube

#2
DE

DeepL

deepL

#3
CO

Code

code

#4

Cómo importar este flujo de trabajo

  1. 1Haz clic en el botón Descargar JSON a la derecha para guardar el archivo del flujo de trabajo.
  2. 2Abre tu instancia de n8n. Ve a Flujos de trabajo → Nuevo → Importar desde archivo.
  3. 3Selecciona el archivo auto-translate-youtube-videos-to-japanese-with-deepl-and-post-to-slack descargado y haz clic en Importar.
  4. 4Configura las credenciales para cada nodo de servicio (claves API, OAuth, etc.).
  5. 5Haz clic en Probar flujo de trabajo para verificar que todo funcione, luego actívalo.

O pega directamente en n8n → Importar desde JSON:

{ "name": "Auto-Translate YouTube Videos to Japanese with DeepL and Post to Slack", "nodes": [...], ...}

Integraciones

codedeeplifmergerssfeedreadslackyoutube

Obtener este flujo de trabajo

Descarga e importa con un solo clic

Descargar JSONVer en n8n.io
Nodos9
Complejidadmedium
Disparadormanual
CategoríaSupport

Creado por

noda

noda

@shusaku

Etiquetas

codedeeplifmergerssfeedreadslackyoutube

¿Nuevo en n8n?

n8n es una herramienta de automatización de flujos de trabajo gratuita y de código abierto. Alójala tú mismo o usa la versión en la nube.

Obtener n8n gratis →

Related Support Workflows

EMFIGOGO+5
medium

Scalable Cold Email Automation via Google Docs & n8n

Stop wasting hours manually copy-pasting email content. This high-performance n8n workflow transforms your Google Sheets database into a dynamic outreach engine. By leveraging Google Docs as a centralized template manager, you can maintain rich formatting while injecting personalized variables like first names, company details, and custom offers into every message. Unlike basic mail merges, this automation features a sophisticated 'Split in Batches' logic and integrated 'Wait' nodes to ensure your SMTP server remains in good standing, effectively bypassing spam filters associated with high-frequency sending. The process begins by fetching contact data, merging it with your Doc-based template, and executing a controlled delivery sequence. This is the ideal solution for growth teams and account managers who need the flexibility of a CRM without the high monthly costs. Whether you are sending monthly newsletters or executing targeted sales sequences, this workflow provides a robust, self-hosted alternative to expensive marketing platforms, giving you full control over your deliverability and data privacy. **Common Use Cases:** - Personalized B2B Sales Outreach: Automatically pull lead data from a spreadsheet to send customized cold pitches that look hand-written. - Automated Client Onboarding: Trigger a welcome sequence that pulls specific project details from a Master Sheet into a formatted Google Doc welcome letter. - Internal Corporate Announcements: Distribute tailored department updates to hundreds of employees with personalized performance metrics or specific team instructions.

Scheduled·12 nodes
DIEXIFMA+2
medium

How to Map Discord Server Structure with n8n (API Tutorial)

Architecting a robust Discord automation begins with a precise understanding of your server's hierarchy. This advanced n8n template serves as a diagnostic and structural mapping tool, moving beyond basic connectivity tests to provide a comprehensive audit of your Discord environment. By programmatically fetching every category and channel ID, it eliminates the manual guesswork often associated with configuring Discord bots. The workflow utilizes a strategic multi-step approach: first, it validates your OAuth2 or Bot Token credentials; next, it executes a recursive GET request to the Discord API; and finally, it parses the JSON response into a clean, actionable data structure. For businesses scaling community operations, this flow is essential for auditing permissions, preparing for mass-message deployments, or syncing server structures with external databases. Instead of hard-coding channel IDs, use this workflow to dynamically discover your server's architecture, ensuring your automated workflows remain resilient even when channels are renamed or reorganized. **Common Use Cases:** - Dynamic Channel Mapping for Automated Community Onboarding - Automated Security Audits of Discord Server Permissions and Categories - Database Synchronization of Server Structures for Multi-Tenant Bot Management

Trigger·9 nodes
COFIGMGO+5
medium

Automate GoHighLevel Contract Renewals: Slack & Gmail Sync

Stop losing revenue to expired contracts and missed follow-ups. This professional n8n automation creates a fail-safe system for client retention by bridging GoHighLevel CRM with your team's communication stack. Instead of manually auditing account dates, this workflow autonomously scans your GHL database every morning to identify subscriptions or agreements set to expire within a 10-day window. The logic begins with a scheduled trigger that pulls comprehensive client data, passing it through a validation and filtering layer to ensure only active, relevant accounts are processed. Once an expiring contract is identified, the workflow executes a multi-channel notification strategy: it sends a personalized, high-touch email via Gmail to the client, alerts the dedicated account manager via Slack for immediate awareness, and logs the entire event in Google Sheets for executive reporting. By centralizing renewal tracking and automating the outreach phase, agencies can significantly increase their LTV (Lifetime Value) and eliminate the human error associated with manual CRM management. This is an essential template for any high-growth agency looking to scale their operations without increasing administrative overhead. **Common Use Cases:** - SaaS Subscription Recovery: Automatically notify users 10 days before their annual plan expires to prevent involuntary churn. - Marketing Agency Retainer Tracking: Alert account managers when a client's 6-month service agreement is nearing completion to trigger upsell conversations. - Professional Service Compliance: Track certification or insurance expiration dates for vendors managed within GoHighLevel and maintain a master log in Google Sheets.

Scheduled·10 nodes
COGMGOIF+5
medium

Automate AI Customer Sentiment Analysis & PDF Reporting (n8n)

This advanced n8n workflow revolutionizes how businesses handle user input by transforming raw feedback into high-level business intelligence. Instead of manually sorting through surveys, this automation leverages OpenAI to perform instant sentiment analysis and categorization. The engine processes incoming webhooks, uses custom JavaScript logic to structure data, and generates professional-grade PDF summary reports via HTML/CSS conversion. To ensure stakeholders stay informed, it executes a multi-channel distribution strategy: archiving data in Google Sheets for long-term tracking, alerting teams via Slack for immediate action, and sending personalized follow-up emails through Gmail. This end-to-end pipeline eliminates manual data entry and ensures that critical customer pain points are addressed in real-time. It is the perfect solution for Product Managers and Success Teams who need to scale their feedback loops without increasing headcount, providing a transparent, documented trail of customer satisfaction trends from the moment a form is submitted. **Common Use Cases:** - SaaS Product Feedback & Feature Request Prioritization - Post-Purchase E-commerce Satisfaction Surveys with Executive Reporting - Automated B2B Client Health Scoring and Account Management Alerts

🔗 Webhook·12 nodes
@AGMLIOP+2
medium

Sync LinkedIn Posts to Email Newsletters via AI & Apify

This advanced n8n automation bridges the gap between social media presence and direct email marketing, ensuring your best insights never go to waste. By integrating Apify’s scraping capabilities with GPT-4’s generative intelligence, the workflow systematically extracts your latest LinkedIn updates and refines them into polished, subscriber-ready newsletter drafts. It begins with a scheduled trigger that initiates an Apify actor to fetch recent profile activity. The raw data is then processed through OpenAI’s Large Language Models, which summarize the key takeaways, adjust the tone for an email audience, and generate compelling subject lines. Finally, the formatted content is dispatched via Gmail, effectively turning your social feed into a self-sustaining content engine. This is an essential tool for thought leaders and agency owners who need to maintain a multi-channel presence without doubling their production time. It eliminates the friction of manual copy-pasting and ensures your email list stays engaged with your most current professional insights automatically. **Common Use Cases:** - Personal Brand Content Multiplier - Automated Weekly Thought Leadership Digest - B2B Social-to-Email Marketing Funnel

Scheduled·7 nodes